PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0122s0053.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 512aa    MW: 56060.9 Da    PI: 7.0107
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0122s0053.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.57.4e-30205262260
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           DgynWrKYGqK+vkg efprsYY+Ct+++C+vkk +er++ d++++e++Y+g+H h+k
  Kalax.0122s0053.1.p 205 TDGYNWRKYGQKHVKGCEFPRSYYKCTHPNCEVKKLLERNH-DGRITEVIYKGTHAHPK 262
                          6***************************************9.***************85 PP

2WRKY1023.4e-32368426159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Ct agCpv+k+ver+ +d k v++tYeg+Hnh+
  Kalax.0122s0053.1.p 368 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNAGCPVRKHVERACHDIKSVITTYEGKHNHD 426
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.7E-26197263IPR003657WRKY domain
PROSITE profilePS5081122.378199263IPR003657WRKY domain
SuperFamilySSF1182901.7E-23202263IPR003657WRKY domain
SMARTSM007741.2E-31204262IPR003657WRKY domain
PfamPF031064.2E-23206261IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-36353428IPR003657WRKY domain
SuperFamilySSF1182901.28E-28360428IPR003657WRKY domain
PROSITE profilePS5081138.262363428IPR003657WRKY domain
SMARTSM007741.6E-36368427IPR003657WRKY domain
PfamPF031068.4E-25369426IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MNLTNPHSAS DHLGRSGPHD PRFVPSHSTI PSPPAATEAA DTVVATVSSI PNVSRYKLMS  60
PAKLPISRSM PHTAPPGLSP SSLLDSPVQF CNIKVEPSPT TGTLHKPQPM LGGVGYAAAA  120
STSYANNSAC VGKISDNSEF GTQSQSNFAT GSSLLPSQAF PVTESQQYEL QSQHIEGEKA  180
IQYATASPPD QNEVRLSAVS DNSSTDGYNW RKYGQKHVKG CEFPRSYYKC THPNCEVKKL  240
LERNHDGRIT EVIYKGTHAH PKPQSKRRFP NDSVMGTTDE HLERFSYQSE EMALGASAAT  300
PDMDGTSEFP SGPPSDEELN DDKYDDDGDD PNSKRRKQDM GVVHFISSVK PIREPRVVVQ  360
TVSEVDILDD GYRWRKYGQK VVKGNPNPRS YYKCTNAGCP VRKHVERACH DIKSVITTYE  420
GKHNHDVPAA KSNNQEASAA AVDPFSSYTA NMGSSSVMQN DSVTQVSARY QLPPNFRNQY  480
PDNEGENFRF ATPYLSSNAY PQNLRSLQMG P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-36206429878Probable WRKY transcription factor 4
2lex_A5e-36206429878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298853.11e-130WRKY-like drought-induced family protein
SwissprotQ93WV01e-121WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLB9GJX11e-130B9GJX1_POPTR; WRKY-like drought-induced family protein
STRINGPOPTR_0001s37260.11e-130(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.11e-94WRKY family protein